1. What is Cagrilintide?
Cagrilintide is a synthetic peptide designed as a long-acting amylin analog. Amylin is a hormone co-secreted with insulin in the pancreas that contributes to satiety, gastric emptying, and postprandial glucose regulation. Cagrilintide has been studied in preclinical and clinical research for its potential role in metabolic regulation, appetite signaling, and energy balance.
2. Cagrilintide Structure
Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Molecular Formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂.xC₂H₄O₂
Molecular Weight: 4409.01 g/mol
PubChem SID: 171397054
CAS Number: 1415456-99-3
3. Cagrilintide Research
Research Context
Cagrilintide has been evaluated as a long-acting amylin analogue in studies of satiety regulation, gastric motility, and metabolic homeostasis. By binding to amylin receptors, it has been shown to influence hunger signaling and nutrient handling in research settings.
【1】 Dual Mechanistic Pathways
l Central signaling: Acts on appetite centers in the brainstem (area postrema, nucleus tractus solitarius) to reduce hunger perception.
l Gastric emptying: Slows food passage from the stomach, supporting satiety and steady glucose profiles.
【2】 Combination Research with GLP-1 Agonists
Recent studies have investigated co-administration of Cagrilintide with GLP-1 receptor agonists such as semaglutide. These exploratory findings suggest potential additive effects on appetite and body weight regulation beyond either agent alone 【see STEP-8 and REDEFINE trial data at ClinicalTrials.gov】.
【3】 Broader Research Directions
Emerging investigations are examining possible roles in:
l Non-alcoholic fatty liver disease (NAFLD) models
l Insulin resistance research
l Cardiometabolic biomarkers such as lipid metabolism and blood pressure
4.Future Cagrilintide Research
Future studies aim to expand understanding of Cagrilintide’s long-term effects, mechanistic pathways, and co-formulations.
l Extended duration studies: Ongoing trials are evaluating outcomes beyond 1 year, particularly regarding weight maintenance 【ClinicalTrials.gov: NCT06780449】.
l Combination approaches: Dual formulations such as CagriSema (Cagrilintide + Semaglutide) are being explored for synergistic potential.
l Metabolic versatility: Research continues in Type 2 diabetes and NAFLD populations, focusing on glycemic control, hepatic fat, and cardiometabolic risk.
l Mechanistic expansion: Investigations include hypothalamic pathways, gastric motility, and peripheral energy expenditure 【review in Cell Metabolism】.
l Next-generation research: Explorations into triple-therapy strategies, optimized dosing, and predictive biomarkers may further refine its application in metabolic science.
5.Application Area
Cagrilintide is actively studied in:
l 🧪 Laboratory research on energy balance and hormone analogs
l 🧬 Metabolic disease modeling (including obesity, insulin resistance, NAFLD)
l 🧠 Neuroendocrine studies of hypothalamic appetite control
l ⏳ Aging and metabolic health investigations
l 🏋️ Exercise physiology and body composition research
Its long-acting profile and receptor specificity make it a strong candidate of interest in next-generation metabolic and obesity research pipelines.
⚠ Disclaimer
ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY.
The products offered on this website are furnished for in-vitro studies only. In-vitro studies (Latin: in glass) are performed outside of the body. These products are not medicines or drugs and have not been approved by the FDA to prevent, treat, or cure any medical condition, ailment, or disease. Bodily introduction of any kind into humans or animals is strictly forbidden by law.
